Cloud Computting !!! it Rocks

 Calculation describes cloud computing, software, data access, hosting services do not require end-user knowledge of the physical locations of system configuration that provides the services. Parallels to this approach to the electricity grid can be deduced that end users consume power resources without understanding is no need of network element devices required to deliver the service.

Cloud computing is a natural evolution of the widespread adoption of virtualization, service-oriented architecture, autonomic computing service. Details are abstract from all end users who already do not have expertise, or control over the infrastructure, technology and "cloud" that supports them.

 Cloud computing a new supplement, consumption, and delivery model for IT services based on Internet Protocol is described, and it is usually dynamic and scalable virtualized resource provision is often a return and results. The rest - remote computing access to Internet sites provided by the web-based tools or applications that users often use a Web browser as if it's a locally installed programs on your own computer through the use could takes the form ..




What is a world-class CIOs do today operate more efficiently and cost-effective than their peers? The answer is cloud computing. Experienced CIO, Fred Mapp, introduced a new cloud computing white paper today entitled "The chances of confusing the sun." White Paper by the OneNeck IT Services, describes the benefits of cloud computing and explain the different the shape and form of cloud computing.

CIOs, IT managers, and employees are dealing with the challenges keep pace with technology changes to meet the IT function from the IT budget and chief financial officer for the business units to reduce the increasing demand. These challenges are being considered to resolve the cloud to achieve management IT applications and infrastructure flexibility and scalability of the company. However, many companies are still reluctant to make the leap to the cloud.


Fred Max-Planck-sharing, "corporate management, in particular CIO are still hesitant and slow migration to the cloud. Legitimate concerns exist with any new technology or platform development trend. CIO who does not completely sell the value of the cloud and its How to meet the company's information technology plan. "



Mapp continued, "IT transformation may be difficult to change, but the fact is that today's mobile Internet needs of engineering and IT environments, providing a new method of business applications. Cloud computing will move to the forefront of the market is not just a buzzword , but will provide huge benefits the company, to accept it. "

Complimentary White Paper on cloud computing services from OneNeck IT in
http://www.oneneck.com/cloud-computing-white-paper.cfm

Try cloud computing and receive a $25 credit.

Use "Cheat Engine" to increase the download speed for Mu torrent!!!

If you are using Bit torrent, Mu torrent or U torrent and if you want to optimize the speed of download, do follow following simple steps.

It works!!!!

You know... first you have to download Cheat Engine!

Follow the link to do so.....

http://www.cheatengine.org/downloads.php

current version is 6, but if you have the older one that is 5 and advanced.... no problem, it works

1. install the software by following just simple steps during installation

2. Install Bit/Mu/U torrent down loader

3. get your favorite torrent from  the web.

4. Star downloading and inactivate your anti-virus shield

5. Now click on cheat engine icon on desktop to star cheat engine, you will see following interface

6. Select process designating your torrent application using following three steps

       1.Click on left most process search icon

      2. Select process... you may not able to recognize number/code.. but icon is visible.. so not to worry about code or number.

      3. click "Done".

7. Now you have selected a process... now its time to increase the speed of download.... now check the check-box "Enable speed Hack" one right hand side on cheat engine application

8. Default value appear as 1.0..... now replace 1.0 with 0.1

9.Apply option will be appear and click apply.....

Bingo!!!!! You have done it!!!!!

you will see the increase in download speed up to your allotted bandwidth.....

Enjoy Downloading!!!!

FASTA format of biological sequence representation and small Perl script to create the format.....

FASTA format can be used to represent either one or several sequences of the sequence in one file. Series of one sequence, combined, represent multisequence file. The best source for the description of FASTA / Pearson format documentation Suite FASTA programs. It can be downloaded from any of the free distribution of FASTA and advise its own (see fasta20.doc, fastaVN.doc or fastaVN.me - where VN is the version number).

Sequence in FASTA format is represented as a series of lines that should be no longer than 120 characters, and usually does not exceed 80 characters. This is probably because for preallocation fixed-sized lines in the software: while the majority of users rely on Dec. VT (or compatible) terminals that can display 80 or 132 characters per line. Most people prefer a large font in the 80-character mode, and so was the recommended mode to use 80 characters or less (often 70) in the line of FASTA.

The first line in the FASTA file begins with either ">" ("more") or the symbol ";" (semicolon) and was accepted as a comment. Follow the lines beginning with a semicolon will be ignored by the software. Since only the comment used in the first place, it quickly became used to store a brief description of the sequence, often beginning with a unique number, joining the library, and eventually it became a routine use to always use the ">" on the front line and do not use "; "comments (which are otherwise ignored.)

After the initial line (used to uniquely describe the sequence) is the actual sequence itself into a standard single letter code. Nothing but the correct code will be ignored (including spaces, tabs, asterisks, etc. ..). Originally it was also common for the end of the sequence with "*" (asterisk) character (by analogy with the PIR formatted sequence) and, for the same reason, to leave a blank line between description and sequence.

For example......this is protein sequence of SOS protein involve in signalling pathaway in fruit fly

>gi|18110536|ref|NP_476597.2| Son of sevenless [Drosophila melanogaster]
MFSGPSGHAHTISYGGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAGLQDCDGYDFTKCENAARWR
GLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEKVNKSFPAPIDQWALNE
AKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLVAVLEYISADILKMAGDYVIKIAHCEITKE
DIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQRASATYEETVKELIHDEKQYQRDLHMIIRVFREELVK
IVSDPRELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQ
ASRDALNNLLSKPGASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQV
QGLLHPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNEFIREDSLSKL
GSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRRVDINDRPDSDDLKNSFELAP
RMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSILQDIERKHPLRMPSPEIYKFAVPDSGDNIVL
EERESAGVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDT
GTAGAGGMGGVGGDKEHKNSHREDWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLE
HVNGKSMRKWVDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLL
EFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMMV
MLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHLKKYQERLRSINPPCVPFFG
RYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLNEESTIRQFFEQLDPFNGLSDK
QMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNSTSSVAAAAAASSTAT
SIATASAPSLHASSIMDAPTAAAANAGSGTLAGEQSPQHNPHAFSVFAPVIIPERNTSS

Lets learn a Perl script that take a string as a input from a file (String represent sequence of nucleotide and /or protein) as an input and generate FASTA format.

#!/usr/bin/perl

$file = $ARGV[0];   # .....input file name from argument

open(FH, $file);       #........ Use file handle

@file_aray = <FH>;     #....... Take all the file lines in one array

close(FH);                    #.......... Close the file

foreach $line(@file_aray)

{

     chomp $line;

     push @temp, $line;

}

$sequence = join('',@temp);

print ">Sequence1\n"

$counter = 0;

@seqaray = split(//,$sequence);

for($i = 0; $i>@seqaray;$i++)

{

       print $seqaray[$i];

       $counter++;

       if ($counter eq 60)

      {

              print "\n";

              $counter = 0;

       }

}

Indexing and hashing in Databases 2

Architectures ranking list as can be clustered or nonclustered.

Non-clustered

The data is in random order, but the logical order is specified by index. This random data row can be spread across the table. Non-clustered index tree list in order of keys and the page data page containing the row index number signal with a leaf surface. Non-clustered index:

    * Row index of the physical system is not like the command.
    * Commonly used to join the column, where, and provisions, created by Order.
    * Tables whose values may be revised again and again is good for.

Microsoft SQL Server creates an index by default when creating clustered index is ordered. And a database on a table can be non-clustered index. According to the table many as 249 nonclustered indexes can be. Also default a clustered index on primary key is created

Clustered

Clustering in a particular setting such specific data block list, match data row as a result of being stored in order. Therefore, only one clustered index on the table in the database can be created. Clustered index to get a lot faster overall, more, but usually only where the clustered index data, or when a range of items is selected, the same or in reverse order from a set can.

Since physical records on disk in such order, the next line item in the series immediately before or after the last one, and very few pieces of information are required to read. The main feature is a list of clustered so that they block the index pointed to the row of data is the ruling body. Something different database files and index data in separate pieces, others the same physical file (s) within two different data blocks moved. Where lines of anything related to physical order list and order of the list of clustered level (leaf) is the same as the original data include lines.
Oracle under the database is known as "tables list announced"

Indexing and hashing in Databases

A database index is a data structure that improves the write speed of data recovery operations on a database table at the expense of the slower and more memory. Indexes can be created with one or more columns in a database table, which is the basis for both rapid random lookups and efficient access of ordered records. The disk space required to store the index is usually less than the required by the table (since indices usually contain only the key fields by which the table is arranged, and excludes all other information in the table), raising the possibility to store indices in memory for a table whose data is too large to store in memory.

In a relational database, an index is a copy of a portion of a table. Some databases extend the power of indexing by indexes are created on functions or expressions. For example, an index on upper (last_name) are created, which only store the uppercase versions of the last_name field in the index. Another option sometimes supported the use of "filtered" indices, where index entries for only those records that satisfy the conditional expression to be created. Another aspect of flexibility is the indexing on user-defined functions, as well as expressions formed from an assortment of built-in functions allow.

Indexes can be defined as unique or not unique. A unique index acts as a constraint on the table by preventing duplicate entries in the index and hence the support table